PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009610111.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB
Protein Properties Length: 255aa    MW: 29461 Da    PI: 9.0291
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009610111.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding61.71.5e-191865148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd+ll ++v+++G g+W++++r+ g++R +k+c++rw +yl
   XP_009610111.1 18 KGPWTPEEDKLLSEYVNLHGEGRWSSVSRCAGLNRNGKSCRLRWVNYL 65
                     79********************************************97 PP

2Myb_DNA-binding51.32.6e-1671115147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg  T++E+ +++++++++G++ W+tIar+++ gRt++++k++w+++
   XP_009610111.1  71 RGHITPQEEGIIIELHALWGNK-WSTIARYLP-GRTDNEIKNYWRTH 115
                      6778******************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.8911365IPR017930Myb domain
SuperFamilySSF466891.27E-3115112IPR009057Homeodomain-like
SMARTSM007171.1E-161767IPR001005SANT/Myb domain
PfamPF002497.3E-181865IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-231972IPR009057Homeodomain-like
CDDcd001676.03E-122065No hitNo description
PROSITE profilePS5129424.89266120IPR017930Myb domain
SMARTSM007172.3E-1470118IPR001005SANT/Myb domain
PfamPF002493.6E-1471115IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.6E-2473119IPR009057Homeodomain-like
CDDcd001678.98E-1075116No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009737Biological Processresponse to abscisic acid
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 255 aa     Download sequence    Send to blast
MVGIMGWGAN SDQQGWRKGP WTPEEDKLLS EYVNLHGEGR WSSVSRCAGL NRNGKSCRLR  60
WVNYLRPGLK RGHITPQEEG IIIELHALWG NKWSTIARYL PGRTDNEIKN YWRTHFKKKE  120
KASKQGKKKN LRQRNQQQQN CTNANNKFSP KAEEAIMQKN DEKNDNEYQD MVAFTNYHQS  180
MDQDRVMDLP PVVTTSSDIS YAWTDTIPMD GLWGGLWNLD VDDKCKVAIQ NQPTTANYSY  240
TTDYAVNLYN GGFIF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-24181197107B-MYB
1h8a_C5e-241811927127MYB TRANSFORMING PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00388DAPTransfer from AT3G30210Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754411e-54HG975441.1 Solanum pennellii chromosome ch02, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009610111.10.0PREDICTED: myb-related protein 340
TrEMBLM0ZLR91e-124M0ZLR9_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000034791e-123(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G30210.16e-72myb domain protein 121